Search — alldone.jobs

Searching the record

1,027 RESULTS

Searching all 336,909 software and computer-occupation postings, April through July 2026 (July is a partial month) — direct employer postings from large U.S. employers.

The posting, as the record holds it
Principal Infrastructure Engineer- Data Center Networking
As a Principal Infrastructure Engineer at JPMorgan Chase within the Data Center Networking group, you will leverage your extensive knowledge of software, applications, and technical systems and processes in infrastructure engineering, along with advanced expertise in other disciplines. You will contribute to the development of technical methods in a specialized field or area, aligning with product development methodologies. Your role involves applying in-depth expertise and problem-solving methodologies to plan, accomplish, and review tasks across multiple large-scope projects in various techn
Employer
JPMorgan Chase
Seniority
Mid-level
Work arrangement
Onsite
Location
Jersey City, NJ, 07308
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$190,000 – $260,000 / yr
Posting id
job-6adb6fcc-3abd-4ead-8031-f8a1c5ed59eb
Skills named in the ad
ciscoaristajunipernetwork architectureautomation frameworksansibleterraformpythoncicd pipelinesbgpevpnvxlanospfisisvlansstpvpcmlagstacking
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Solutions Engineer - Data Visualization
Job Description The Solutions Engineer, Data Visualization is a key contributor within the Microsoft Data and AI practice, responsible for designing and delivering enterprise analytics and data visualization solutions using Microsoft technologies. This role focuses on turning complex data into clear, actionable insights that drive business value. The Solutions Engineer combines deep Power BI expertise with human-centered design and strong client engagement, working closely with engineers, architects, project managers, and stakeholders to deliver secure, scalable, and governed analytics solut
Employer
Insight Global
Seniority
Mid-level
Work arrangement
Onsite
Location
Franklin, NJ, 07416
Metro
New York-Newark-Jersey City, NY-NJ
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
Yes — staffing or agency reposter
Pay range
Not disclosed in the ad
Posting id
job-3e5df89f-0ad3-4115-8f42-87d4924fb9ff
Skills named in the ad
power bisqldata governancehuman centered designaccessibility awarenessmicrosoft fabrictabular editordenebetl processesazure data lakesynapse analyticsdatabricksrow level security
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
GenAI Engineer
Job Description Insight Global is currently seeking a GenAI Engineer to join a large pharmaceutical company. This person will be joining a group responsible for building novel AI/ML solutions supporting the entire R&D lifecycle. This projects focuses on building an AI-assisted platform directly supporting business users with managing documents more quickly, and is an internally built solution. This person would be responsible for joining the project, developing workflows to parse documents, designing/developing RAG/LLM solutions, and creating automated pipelines for business users to interact
Employer
Insight Global
Seniority
Mid-level
Work arrangement
Onsite
Location
Hopewell, NJ, 08525
Metro
Trenton-Princeton, NJ
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
Yes — staffing or agency reposter
Pay range
Not disclosed in the ad
Posting id
job-66510488-488e-4d67-9458-1ea6f314a2a8
Skills named in the ad
pythongenai solution developmentllmrag developmentvector databasesregexwordpdf manipulationpharmaceutical domain experience
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.