Search — alldone.jobs

Searching the record

17 RESULTS

Searching all 336,909 software and computer-occupation postings, April through July 2026 (July is a partial month) — direct employer postings from large U.S. employers.

The posting, as the record holds it
Principal Tech Lead Manager - Embodied AI Evaluation Foundations
Job Description About the Team: The Evaluation Foundations team is a part of the Scaling Foundations team in Embodied AI and is responsible for Building the Largest, most Diverse and highest Quality Datasets for model training and evaluation, now and into the future Utilizing our resources in the most Efficient way, including storage and compute but especially GPUs Minimizing the time of iteration and providing the highest quality introspection tools and evaluation signal to shorten the experimental path towards the best model. Why Join Us ? + Scale upintrospection and e
Employer
General Motors
Seniority
Senior
Work arrangement
Onsite
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$296,300 – $453,900 / yr
Posting id
job-8f060b06-6b58-47a3-bd40-da39444f1eeb
Skills named in the ad
reacttypescriptwebglwebgpustreamlitjupyter notebookspythonhighthroughput data streamingparquetapache sparkbigquerykubernetesrosbagsprotocol bufferscommunication
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Cyber Defense Incident Responder
At EY, we’re all in to shape your future with confidence. We’ll help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you want it to go. Join EY and help to build a better working world. The oppportunity The Director of Enterprise Incident Response & Remediation provides executive leadership for the company’s enterprise‑level cybersecurity incident response capability. The role sets strategic direction, establishes global standards, and exercises oversight across incident response, supplier cyber incident coordination, and enterprise remediat
Employer
EY
Seniority
Mid-level
Work arrangement
Onsite
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$220,000 – $435,600 / yr
Posting id
job-c59f47d3-8765-42f5-a95b-38d3aca74ef9
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Senior Distinguished Software Engineer (Remote-Eligible)
Senior Distinguished Software Engineer (Remote-Eligible) As a Sr. Distinguished Engineer at Capital One, you will be a part of a community of technical experts working to define the future of banking in the cloud. Our Distinguished Engineering team architects the strategic modernization of core credit card platforms to ensure industry-leading architectural resilience and performance. This role involves working with partner teams to integrate new data into the decision making process in an ongoing effort to make the highest quality decisions possible. We simultaneously lead the technical orch
Employer
Capital One
Seniority
Senior
Work arrangement
Remote
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$286,200 – $392,000 / yr
Posting id
job-cbd9875d-f48f-414d-ab12-dc42fbd340a6
Skills named in the ad
software engineeringsolution architectureenterprise architecturedesign patternsjavapythongopublic cloud technologiesprivate cloud technologiesdistributed systems
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Distinguished Engineer - Risk Tech (Remote - Eligible)
Distinguished Engineer - Risk Tech (Remote - Eligible) As a Distinguished Engineer at Capital One, you will be a part of a community of technical experts working to define the future of banking in the cloud. You will work alongside our talented team of developers, machine learning experts, product managers and people leaders. Our Distinguished Engineers are leading experts in their domains, helping devise practical and reusable solutions to complex problems. You will drive innovation at multiple levels, helping optimize business outcomes while driving towards strong technology solutions. At
Employer
Capital One
Seniority
Mid-level
Work arrangement
Remote
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$244,700 – $279,200 / yr
Posting id
job-89ff035a-6ee2-4e91-90f5-0515c5a2d292
Skills named in the ad
artificial intelligencemachine learningreliability engineeringobservability toolingcloud computingdata architecture
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Staff Software Engineer, Backend (Consumer - Advanced Trading)
Ready to be pushed beyond what you think you’re capable of? At Coinbase, our mission is to increase economic freedom in the world. It’s a massive, ambitious opportunity that demands the best of us, every day, as we build the emerging onchain platform — and with it, the future global financial system. To achieve our mission, we’re seeking a very specific candidate. We want someone who is passionate about our mission and who believes in the power of crypto and blockchain technology to update the financial system. We want someone who is eager to leave their mark on the world, who relishes the p
Employer
Coinbase
Seniority
Mid-level
Work arrangement
Onsite
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Medium employer
Staffing / agency
No — direct employer
Pay range
$218,025 – $256,500 / yr
Posting id
job-5267bad8-b949-4e79-b988-c3307d060052
Skills named in the ad
gomongodbredissnowflakegenerative ai tools
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Senior Engineer, Machine Learning (ML)
Senior Engineer, Machine Learning (ML) Company: Norstella Location: Remote, United States Date Posted: Apr 21, 2026 Employment Type: Full Time Job ID: R-1921 Description About Us At Norstella, our mission is simple: to help our clients bring life-saving therapies to market quicker—and help patients in need. Founded in 2022, but with history going back to 1939, Norstella unites best-in-class brands to help clients navigate the complexities at each step of the drug development life cycle —and get the right treatments to the right patients at the right time. Each organization (Ci
Employer
Norstella
Seniority
Senior
Work arrangement
Remote
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Medium employer
Staffing / agency
No — direct employer
Pay range
$200,000 – $215,000 / yr
Posting id
job-83a6b778-ff34-4e3e-b038-4f18c47f182d
Skills named in the ad
pythonpandasnumpyawssagemakeramazon ecsamazon s3snowflakemlopssystem designlatency optimizationcloud infrastructureknowledge graphsdistributed systemsalgorithm designcoachingproblem solvingcommunicationhealthcare domain knowledge
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Principal Software Engineer - Android platform/AOSP/AAOS
Job Description Work arrangement : Remote: This role is based remotely but if you live within a 50-mile radius of Mountain View, CA you are expected to report to that location three times per week, at minimum. The Role The Vehicle Experiences Engine software team is a dynamic and fast paced team that designs, develops, and maintains the embedded software platform for Infotainment and Software Defined Vehicle. We are looking for a seasoned technical leader with a broad range of experiences with embedded Android platform who can guide development teams and product engineering by b
Employer
General Motors
Seniority
Senior
Work arrangement
Remote
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$238,700 – $365,700 / yr
Posting id
job-f3657f54-dbd3-4bd5-844a-67e351484c2a
Skills named in the ad
javac++candroid aospsoc architectureinterpersonal leadershiptechnical communication
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Staff Software Engineer, Backend - Platform (Payment Rails)
Ready to be pushed beyond what you think you’re capable of? At Coinbase, our mission is to increase economic freedom in the world. It’s a massive, ambitious opportunity that demands the best of us, every day, as we build the emerging onchain platform — and with it, the future global financial system. To achieve our mission, we’re seeking a very specific candidate. We want someone who is passionate about our mission and who believes in the power of crypto and blockchain technology to update the financial system. We want someone who is eager to leave their mark on the world, who relishes the p
Employer
Coinbase
Seniority
Senior
Work arrangement
Onsite
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Medium employer
Staffing / agency
No — direct employer
Pay range
$218,025 – $256,500 / yr
Posting id
job-92ae146c-c17a-46ab-ba8c-9d476e43e920
Skills named in the ad
payment systemsdistributed systemsapi designai toolsleadership
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Distinguished Engineer (Remote - Eligible)
Distinguished Engineer (Remote - Eligible) As a Distinguished Engineer at Capital One, you will be a part of a community of technical experts working to define the future of banking in the cloud. You will work alongside our talented team of developers, machine learning experts, product managers and people leaders. Our Distinguished Engineers are leading experts in their domains, helping devise practical and reusable solutions to complex problems. You will drive innovation at multiple levels, helping optimize business outcomes while driving towards strong technology solutions. At Capital One,
Employer
Capital One
Seniority
Executive
Work arrangement
Remote
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$244,700 – $335,100 / yr
Posting id
job-acafbf62-e4e8-4522-96ce-1ae41452c0f3
Skills named in the ad
cloud computingdata architectureevent driven architecturesrealtime architecturesjavapythonjavascripttypescriptsdlcsystems designai or machine learning concepts
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Sr. Distinguished Software Engineer - AML (Remote - Eligible)
Sr. Distinguished Software Engineer - AML (Remote - Eligible) As a Sr. Distinguished Engineer at Capital One, you will be a part of a community of technical experts working to define the future of banking in the cloud. You will work alongside our talented team of developers, machine learning experts, product managers and people leaders. Our Distinguished Engineers are leading experts in their domains, helping devise practical and reusable solutions to complex problems. You will drive innovation at multiple levels, helping optimize business outcomes while driving towards strong technology sol
Employer
Capital One
Seniority
Senior
Work arrangement
Remote
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$286,200 – $326,700 / yr
Posting id
job-0f066e6d-c5e3-4b28-9bfa-d2317c394a9a
Skills named in the ad
software engineeringsolution architecturecloud computingawsazuregcpdata architectureantimoney launderingknow your customerfinancial crime
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Distinguished Engineer, AI
Our Mission As the world’s number 1 job site*, our mission is to help people get jobs. We strive to cultivate an inclusive and accessible workplace where all people feel comfortable being themselves. We're looking to grow our teams with more people who share our enthusiasm for innovation and creating the best experience for job seekers. (*Comscore, Total Visits, March 2025) Day to Day As Distinguished Engineer, AI at Indeed, you will be instrumental in revolutionizing hiring through artificial intelligence. You’ll work with hundreds of engineers across the company to build an AI pl
Employer
Indeed
Seniority
Senior
Work arrangement
Onsite
Location
Milwaukee, WI, 53208
Metro
Milwaukee-Waukesha, WI
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
Yes — staffing or agency reposter
Pay range
$230,000 – $481,000 / yr
Posting id
job-7b41f96d-bebf-4689-aa02-40783e34af16
Skills named in the ad
artificial intelligencemachine learningai platformsproduction ml systemstechnical directioncommunicationcollaborationresponsible ai
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Staff Software Engineer, Backend - Platform (Overseer)
Ready to be pushed beyond what you think you’re capable of? At Coinbase, our mission is to increase economic freedom in the world. It’s a massive, ambitious opportunity that demands the best of us, every day, as we build the emerging onchain platform — and with it, the future global financial system. To achieve our mission, we’re seeking a very specific candidate. We want someone who is passionate about our mission and who believes in the power of crypto and blockchain technology to update the financial system. We want someone who is eager to leave their mark on the world, who relishes the p
Employer
Coinbase
Work arrangement
Onsite
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Medium employer
Staffing / agency
No — direct employer
Pay range
$218,025 – $256,500 / yr
Posting id
job-04a50288-9f08-40e9-a944-03385a51e5f4
Skills named in the ad
gorubydockerpostgresqlmongodbdynamodbkafkaapache flinkai guardrailsgenerative ai tools
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Sr Lead Software Engineer, Full Stack AI MCP - Shopping (Remote-Eligible)
Sr Lead Software Engineer, Full Stack AI MCP - Shopping (Remote-Eligible) Do you love building and pioneering in the technology space? Do you enjoy solving complex business problems in a fast-paced, collaborative, inclusive, and iterative delivery environment? At Capital One Shopping, you'll be part of a big group of makers, breakers, doers and disruptors, who love to solve real problems and meet real customer needs. We are seeking a Senior Lead Software Engineer who is passionate about marrying data with emerging technologies. As a full stack engineer focusing on AI, you’ll have the o
Employer
Capital One
Seniority
Senior
Work arrangement
Remote
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$209,000 – $238,500 / yr
Posting id
job-aef73777-fb7c-4aa9-a886-d0a032408db8
Skills named in the ad
javascripthtmlcsstypescriptsqlpythongoawsazuregcpdockerkubernetesmcp ai toolingllms
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Sr. Director, Machine Learning Engineering (Remote-Eligible)
Sr. Director, Machine Learning Engineering (Remote-Eligible) Overview: At Capital One, we are creating responsible and reliable AI systems, changing banking for good. For years, Capital One has been an industry leader in using machine learning to create real-time, personalized customer experiences. Our investments in technology infrastructure and world-class talent — along with our deep experience in machine learning — position us to be at the forefront of enterprises leveraging AI. From informing customers about unusual charges to answering their questions in real time, our applications
Employer
Capital One
Seniority
Senior
Work arrangement
Remote
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$286,200 – $326,700 / yr
Posting id
job-a5295ee5-b934-42de-86c0-732cccfd3d92
Skills named in the ad
pythonjavac++gopytorchtensorflowdatabricksapache airflowkubeflowawsgcpazuredockerkubernetesmlopscommunicationleadership
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Sr Lead Software Engineer, Analytics - Shopping (Remote-Eligible)
Sr Lead Software Engineer, Analytics - Shopping (Remote-Eligible) Do you love building and pioneering in the technology space? Do you enjoy solving complex business problems in a fast-paced, collaborative, inclusive, and iterative delivery environment? At Capital One Shopping, you'll be part of a big group of makers, breakers, doers and disruptors, who love to solve real problems and meet real customer needs. We are seeking a Lead Software Engineer who is passionate about marrying data with emerging technologies. As a Lead Full Stack Engineer, you’ll have the opportunity to be on the f
Employer
Capital One
Seniority
Senior
Work arrangement
Remote
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$209,000 – $238,500 / yr
Posting id
job-235d8ca0-37c5-42e4-80c9-01f74e57a21e
Skills named in the ad
javascriptjavatypescriptsqlpythongoawsazuregcpdockerkuberneteskafkastreaming technologiesagile practicesdistributed microservicesfull stack systems
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Staff Software Engineer (Platform - Identity)
Ready to be pushed beyond what you think you’re capable of? At Coinbase, our mission is to increase economic freedom in the world. It’s a massive, ambitious opportunity that demands the best of us, every day, as we build the emerging onchain platform — and with it, the future global financial system. To achieve our mission, we’re seeking a very specific candidate. We want someone who is passionate about our mission and who believes in the power of crypto and blockchain technology to update the financial system. We want someone who is eager to leave their mark on the world, who relishes the p
Employer
Coinbase
Seniority
Mid-level
Work arrangement
Onsite
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Medium employer
Staffing / agency
No — direct employer
Pay range
$218,025 – $256,500 / yr
Posting id
job-d8ee34cb-cb03-4f00-bbb1-66cf10cdc1a2
Skills named in the ad
gogrpckubernetesservice meshaillm product developmentcommunicationleadership
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Sr. Distinguished Machine Learning Engineer (Remote-Eligible)
Sr. Distinguished Machine Learning Engineer (Remote-Eligible) Overview: At Capital One, we are creating responsible and reliable AI systems, changing banking for good. For years, Capital One has been an industry leader in using machine learning to create real-time, personalized customer experiences. Our investments in technology infrastructure and world-class talent — along with our deep experience in machine learning — position us to be at the forefront of enterprises leveraging AI. From informing customers about unusual charges to answering their questions in real time, our application
Employer
Capital One
Seniority
Senior
Work arrangement
Remote
Location
Madison, WI, 53786
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$286,200 – $326,700 / yr
Posting id
job-dabaefef-b6c1-4563-b2db-d9f894ed44d3
Skills named in the ad
pythonjavac++scalapytorchtensorflowdatabricksapache airflowkubeflowdockerkubernetesawsgcpazurecommunication
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.