Search — alldone.jobs

Searching the record

29 RESULTS

Searching all 336,909 software and computer-occupation postings, April through July 2026 (July is a partial month) — direct employer postings from large U.S. employers.

The posting, as the record holds it
Distinguished Engineer - Risk Tech (Remote - Eligible)
Distinguished Engineer - Risk Tech (Remote - Eligible) As a Distinguished Engineer at Capital One, you will be a part of a community of technical experts working to define the future of banking in the cloud. You will work alongside our talented team of developers, machine learning experts, product managers and people leaders. Our Distinguished Engineers are leading experts in their domains, helping devise practical and reusable solutions to complex problems. You will drive innovation at multiple levels, helping optimize business outcomes while driving towards strong technology solutions. At
Employer
Capital One
Seniority
Executive
Work arrangement
Remote
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$244,700 – $279,200 / yr
Posting id
job-6493ecdf-4593-45a2-a3e8-56e7910c330c
Skills named in the ad
cloud computingdata architectureevent driven architecturesrealtime architecturesjavapythongojavascripttypescriptswiftartificial intelligence
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Principal Tech Lead Manager - Embodied AI Evaluation Foundations
Job Description About the Team: The Evaluation Foundations team is a part of the Scaling Foundations team in Embodied AI and is responsible for Building the Largest, most Diverse and highest Quality Datasets for model training and evaluation, now and into the future Utilizing our resources in the most Efficient way, including storage and compute but especially GPUs Minimizing the time of iteration and providing the highest quality introspection tools and evaluation signal to shorten the experimental path towards the best model. Why Join Us ? + Scale upintrospection and e
Employer
General Motors
Seniority
Executive
Work arrangement
Onsite
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$296,300 – $453,900 / yr
Posting id
job-a9268776-8fa4-438a-9c7f-a8016f9f400e
Skills named in the ad
reacttypescriptwebglwebgpustreamlitjupyter notebookspythonhighthroughput data streamingparquetapache sparkbigquerykubernetes
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Sr Lead Software Engineer, Analytics - Shopping (Remote-Eligible)
Sr Lead Software Engineer, Analytics - Shopping (Remote-Eligible) Do you love building and pioneering in the technology space? Do you enjoy solving complex business problems in a fast-paced, collaborative, inclusive, and iterative delivery environment? At Capital One Shopping, you'll be part of a big group of makers, breakers, doers and disruptors, who love to solve real problems and meet real customer needs. We are seeking a Lead Software Engineer who is passionate about marrying data with emerging technologies. As a Lead Full Stack Engineer, you’ll have the opportunity to be on the f
Employer
Capital One
Seniority
Senior
Work arrangement
Remote
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$209,000 – $238,500 / yr
Posting id
job-2728c3d0-8860-495d-a272-5335138696fd
Skills named in the ad
javascriptjavatypescriptsqlpythongohtmlcssdockerkubernetesawsazuregcpkafkastreaming technologiesagile practices
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Oracle Generative AI Architect Tech Fellow
Oracle Generative AI Architect Tech Fellow Today's chief financial officers (CFOs) and supply chain executives are being asked to improve business performance and shareholder value, along with operational effectiveness and efficiency. Deloitte Oracle Generative AI Architect Tech Fellow's help clients delineate strategy and vision, design and implement process and systems which align with business objectives and have a measurable impact on growth. Do you want to be a part of a team that transforms the business landscape for its clients? Do you want to be on the winning team that drives transfo
Employer
Deloitte
Seniority
Mid-level
Work arrangement
Onsite
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$223,700 – $412,100 / yr
Posting id
job-4962cb5c-05ff-4d3c-9222-48a5ad860c6a
Skills named in the ad
oracle cloud infrastructurepythonsqlrest apisllmsembeddingsragmultiagent systemssecuritycompliancedata governance
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
AI Specialist III
$110-$115 per hour Charlotte, NC Contract Summary: We are one of the largest electric power holding companies in the United States, providing electricity to 7.7 million retail customers in six states. We have approximately 51,000 megawatts of electric generating capacity in the Carolinas, the Midwest and Florida – and natural gas distribution services serving more than 1.6 million customers in Ohio, Kentucky, Tennessee and the Carolinas. We are transforming our customers’ experience, modernizing our energy grid, generating cleaner energy and expanding our natural gas infrastructure to
Employer
US Tech Solutions
Seniority
Senior
Work arrangement
Onsite
Location
Charlotte, NC, 28230
Posted
Apr 2026
Employer size
Medium employer
Staffing / agency
Yes — staffing or agency reposter
Pay range
$228,800 – $239,200 / yr
Posting id
job-53ff620c-efaa-4bd2-bcd5-9f7073a769fa
Skills named in the ad
aws bedrockllm claudepythonaws lambdasaws lambdaaws step functionseventbridgelangchainaws serverless servicesapi gateway
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Staff Software Engineer, Google Cloud Agentic AI
Staff Software Engineer, Google Cloud Agentic AI _corporate_fare_ Google _place_ Sunnyvale, CA, USA; New York, NY, USA; +7 more; +6 more Advanced Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. _info_outline_ XApplicants in San Francisco: Qualified applications with arrest or conviction records will be considered for employment in accordance with the San Francisco Fair Chance Ordinance for Employers and the California Fair Chance Act. In accordance with Washington state law, we are highlighting our com
Employer
Google
Seniority
Senior
Work arrangement
Onsite
Location
Durham, NC, 27722
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$207,000 – $300,000 / yr
Posting id
job-61ae3aa2-8458-4504-8ed9-49c572637a86
Skills named in the ad
c++javapythonkotlingosoftware designarchitecture
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Software Engineer Manager, Google Meets Infrastructure
Software Engineer Manager, Google Meets Infrastructure _corporate_fare_ Google _place_ Durham, NC, USA; Raleigh, NC, USA Advanced Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. _info_outline_ XNote: By applying to this position you will have an opportunity to share your preferred working location from the following: Durham, NC, USA; Raleigh, NC, USA . Minimum qualifications: + Bachelor’s degree, or equivalent practical experience. + 8 years of experience in software development. + 3 years o
Employer
Google
Seniority
Mid-level
Work arrangement
Onsite
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$207,000 – $300,000 / yr
Posting id
job-f6406824-9eb3-48a9-aac8-3efae9adf2b7
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
iOS Native Mobile Developer
$100-$105 per hour Charlotte, NC Contract Duration: 12 months contract with possible extensions Job Responsibilities: Summary: + Client's Customer Mobile App is seeking a creative, self-driven, and seasoned iOS Senior Software Engineer with deep expertise in native mobile application development. This role focuses on building cutting-edge solutions using Swift and SwiftUI, working on challenging problems in customer space that directly impact the daily experiences of both field workers and customers. + Team collaboration, collective work efforts, and knowledge sharing are fu
Employer
US Tech Solutions
Seniority
Senior
Work arrangement
Onsite
Location
Charlotte, NC, 28230
Posted
Apr 2026
Employer size
Medium employer
Staffing / agency
Yes — staffing or agency reposter
Pay range
$208,000 – $218,400 / yr
Posting id
job-80017707-ea62-4a53-a4ab-244db3d10507
Skills named in the ad
swiftuikitswiftuiios frameworksmvcmvvmfirebasecrashlyticsgitunit testingtroubleshootingcommunication
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Senior Engineer, Machine Learning (ML)
Senior Engineer, Machine Learning (ML) Company: Norstella Location: Remote, United States Date Posted: Apr 21, 2026 Employment Type: Full Time Job ID: R-1921 Description About Us At Norstella, our mission is simple: to help our clients bring life-saving therapies to market quicker—and help patients in need. Founded in 2022, but with history going back to 1939, Norstella unites best-in-class brands to help clients navigate the complexities at each step of the drug development life cycle —and get the right treatments to the right patients at the right time. Each organization (Ci
Employer
Norstella
Seniority
Senior
Work arrangement
Remote
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Medium employer
Staffing / agency
No — direct employer
Pay range
$200,000 – $215,000 / yr
Posting id
job-591062a1-c4a7-4ce6-a6f1-c927643c510f
Skills named in the ad
pythonpandasnumpyawssagemakeramazon ecsamazon s3snowflakemlopsdistributed systemsproblem solvingcommunication
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Sr. Distinguished Software Engineer - AML (Remote - Eligible)
Sr. Distinguished Software Engineer - AML (Remote - Eligible) As a Sr. Distinguished Engineer at Capital One, you will be a part of a community of technical experts working to define the future of banking in the cloud. You will work alongside our talented team of developers, machine learning experts, product managers and people leaders. Our Distinguished Engineers are leading experts in their domains, helping devise practical and reusable solutions to complex problems. You will drive innovation at multiple levels, helping optimize business outcomes while driving towards strong technology sol
Employer
Capital One
Seniority
Senior
Work arrangement
Remote
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$286,200 – $326,700 / yr
Posting id
job-4bd1eeb3-81cd-452b-a589-7a86c671d0a8
Skills named in the ad
awsazuregcpapache sparkapache flinkkafkadagsterobservabilityci/cdincident managementfull stack development
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Distinguished Engineer, AI
Our Mission As the world’s number 1 job site*, our mission is to help people get jobs. We strive to cultivate an inclusive and accessible workplace where all people feel comfortable being themselves. We're looking to grow our teams with more people who share our enthusiasm for innovation and creating the best experience for job seekers. (*Comscore, Total Visits, March 2025) Day to Day As Distinguished Engineer, AI at Indeed, you will be instrumental in revolutionizing hiring through artificial intelligence. You’ll work with hundreds of engineers across the company to build an AI pl
Employer
Indeed
Work arrangement
Onsite
Location
Charlotte, NC, 28230
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
Yes — staffing or agency reposter
Pay range
$230,000 – $481,000 / yr
Posting id
job-d5e80750-2524-4c0c-873b-741219051da5
Skills named in the ad
ai platformsproduction ml systemscommunicationcollaborationai trendsresponsible ai
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Cyber Defense Incident Responder
At EY, we’re all in to shape your future with confidence. We’ll help you succeed in a globally connected powerhouse of diverse teams and take your career wherever you want it to go. Join EY and help to build a better working world. The oppportunity The Director of Enterprise Incident Response & Remediation provides executive leadership for the company’s enterprise‑level cybersecurity incident response capability. The role sets strategic direction, establishes global standards, and exercises oversight across incident response, supplier cyber incident coordination, and enterprise remediat
Employer
EY
Seniority
Mid-level
Work arrangement
Hybrid
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$220,000 – $435,600 / yr
Posting id
job-a992dbd6-d74d-490b-8fe2-05079e9160e0
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Principal Software Engineer - Android platform/AOSP/AAOS
Job Description Work arrangement : Remote: This role is based remotely but if you live within a 50-mile radius of Mountain View, CA you are expected to report to that location three times per week, at minimum. The Role The Vehicle Experiences Engine software team is a dynamic and fast paced team that designs, develops, and maintains the embedded software platform for Infotainment and Software Defined Vehicle. We are looking for a seasoned technical leader with a broad range of experiences with embedded Android platform who can guide development teams and product engineering by b
Employer
General Motors
Seniority
Senior
Work arrangement
Remote
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$238,700 – $365,700 / yr
Posting id
job-b19caa2a-3666-425f-b90a-6d8ba928ff49
Skills named in the ad
javac++candroid aospaaossoc architectureembedded systemslinuxqnxreal-time operating systemsinterpersonal leadershiptechnical communication
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Senior Distinguished Software Engineer (Remote-Eligible)
Senior Distinguished Software Engineer (Remote-Eligible) As a Sr. Distinguished Engineer at Capital One, you will be a part of a community of technical experts working to define the future of banking in the cloud. Our Distinguished Engineering team architects the strategic modernization of core credit card platforms to ensure industry-leading architectural resilience and performance. This role involves working with partner teams to integrate new data into the decision making process in an ongoing effort to make the highest quality decisions possible. We simultaneously lead the technical orch
Employer
Capital One
Seniority
Executive
Work arrangement
Flexible
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$286,200 – $392,000 / yr
Posting id
job-503e5670-fe78-4d2b-891c-4ae1118918e3
Skills named in the ad
software engineeringsolution architectureenterprise architecturedesign patternsjavapythongosystem development lifecyclepublicprivate cloud technologieslegacy platform modernization
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Distinguished Engineer (Remote - Eligible)
Distinguished Engineer (Remote - Eligible) As a Distinguished Engineer at Capital One, you will be a part of a community of technical experts working to define the future of banking in the cloud. You will work alongside our talented team of developers, machine learning experts, product managers and people leaders. Our Distinguished Engineers are leading experts in their domains, helping devise practical and reusable solutions to complex problems. You will drive innovation at multiple levels, helping optimize business outcomes while driving towards strong technology solutions. At Capital One,
Employer
Capital One
Seniority
Executive
Work arrangement
Remote
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$244,700 – $279,200 / yr
Posting id
job-55b12af6-a6d4-4831-bf24-8239bd334b86
Skills named in the ad
7+ yrs software engineering7+ yrs solution architecture7+ yrs enterprise architecture5+ yrs cloud computing5+ yrs data architecture10+ yrs codingsdlcartificial intelligencemachine learningreliability engineering
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Sr Lead Software Engineer, Full Stack AI MCP - Shopping (Remote-Eligible)
Sr Lead Software Engineer, Full Stack AI MCP - Shopping (Remote-Eligible) Do you love building and pioneering in the technology space? Do you enjoy solving complex business problems in a fast-paced, collaborative, inclusive, and iterative delivery environment? At Capital One Shopping, you'll be part of a big group of makers, breakers, doers and disruptors, who love to solve real problems and meet real customer needs. We are seeking a Senior Lead Software Engineer who is passionate about marrying data with emerging technologies. As a full stack engineer focusing on AI, you’ll have the o
Employer
Capital One
Seniority
Senior
Work arrangement
Remote
Location
Raleigh, NC, 27608
Metro
Raleigh-Cary, NC
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$209,000 – $238,500 / yr
Posting id
job-b386ecd1-b324-4100-9758-25efe4ad89bb
Skills named in the ad
javascripthtmlcsstypescriptsqlpythongodockerkubernetesawsmcp ai toolingllms
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Software Engineering Manager II, Google Distributed Cloud Hosted
Software Engineering Manager II, Google Distributed Cloud Hosted _corporate_fare_ Google _place_ Durham, NC, USA; Raleigh, NC, USA; +2 more; +1 more Advanced Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. _info_outline_ XNote: By applying to this position you will have an opportunity to share your preferred working location from the following: Durham, NC, USA; Raleigh, NC, USA; Sunnyvale, CA, USA . Minimum qualifications: + Bachelor's degree or equivalent practical experience. + 8 years of e
Employer
Google
Seniority
Mid-level
Work arrangement
Onsite
Location
Durham, NC, 27722
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$207,000 – $300,000 / yr
Posting id
job-b6dd682e-448e-4fa9-8393-9c36617bb8c1
Skills named in the ad
pythoncc++javajavascriptkubernetescloud platforms
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Software Engineer Manager, Google Meets Infrastructure
Software Engineer Manager, Google Meets Infrastructure _corporate_fare_ Google _place_ Durham, NC, USA; Raleigh, NC, USA Advanced Experience owning outcomes and decision making, solving ambiguous problems and influencing stakeholders; deep expertise in domain. _info_outline_ XNote: By applying to this position you will have an opportunity to share your preferred working location from the following: Durham, NC, USA; Raleigh, NC, USA . Minimum qualifications: + Bachelor’s degree, or equivalent practical experience. + 8 years of experience in software development. + 3 years o
Employer
Google
Seniority
Executive
Work arrangement
Flexible
Location
Durham, NC, 27722
Posted
Apr 2026
Employer size
Large employer
Staffing / agency
No — direct employer
Pay range
$207,000 – $300,000 / yr
Posting id
job-ceafeb6d-0e8b-4092-b249-f03bbce300fb
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Staff Software Engineer (Platform - Identity)
Ready to be pushed beyond what you think you’re capable of? At Coinbase, our mission is to increase economic freedom in the world. It’s a massive, ambitious opportunity that demands the best of us, every day, as we build the emerging onchain platform — and with it, the future global financial system. To achieve our mission, we’re seeking a very specific candidate. We want someone who is passionate about our mission and who believes in the power of crypto and blockchain technology to update the financial system. We want someone who is eager to leave their mark on the world, who relishes the p
Employer
Coinbase
Seniority
Senior
Work arrangement
Onsite
Location
Charlotte, NC, 28230
Posted
Apr 2026
Employer size
Medium employer
Staffing / agency
No — direct employer
Pay range
$218,025 – $256,500 / yr
Posting id
job-36a4c82a-ba56-467a-9718-308b0638de94
Skills named in the ad
gogrpckubernetesservice meshaillm developmentcommunication
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.
The posting, as the record holds it
Staff Software Engineer, Backend (Consumer - Advanced Trading)
Ready to be pushed beyond what you think you’re capable of? At Coinbase, our mission is to increase economic freedom in the world. It’s a massive, ambitious opportunity that demands the best of us, every day, as we build the emerging onchain platform — and with it, the future global financial system. To achieve our mission, we’re seeking a very specific candidate. We want someone who is passionate about our mission and who believes in the power of crypto and blockchain technology to update the financial system. We want someone who is eager to leave their mark on the world, who relishes the p
Employer
Coinbase
Seniority
Mid-level
Work arrangement
Onsite
Location
Charlotte, NC, 28230
Posted
Apr 2026
Employer size
Medium employer
Staffing / agency
No — direct employer
Pay range
$218,025 – $256,500 / yr
Posting id
job-89a38b3d-d0bb-4cb9-a2ec-bde246cb20c0
Skills named in the ad
gomongodbredissnowflakegenerative ai tools
The record stores no application link for any posting — this is the listing as the corpus holds it, direct employer postings from large U.S. employers.